Structure of PDB 3lwq Chain B

Receptor sequence
>3lwqB (length=51) Species: 2261 (Pyrococcus furiosus) [Search protein sequence]
RIRKCPKCGRYTLKEVCPVCGEKTKVAHPPRFSPEDPYGEYRRRWKREVL
G
3D structure
PDB3lwq Functional and Structural Impact of Target Uridine Substitutions on the H/ACA Ribonucleoprotein Particle Pseudouridine Synthase .
ChainB
Resolution2.678 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B R34 S36 E38 R31 S33 E35
BS02 ZN B C8 P9 K10 C11 G12 C5 P6 K7 C8 G9
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0030515 snoRNA binding
Biological Process
GO:0001522 pseudouridine synthesis
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3lwq, PDBe:3lwq, PDBj:3lwq
PDBsum3lwq
PubMed20575532
UniProtQ8U1R4|NOP10_PYRFU Ribosome biogenesis protein Nop10 (Gene Name=nop10)

[Back to BioLiP]