Structure of PDB 3lw0 Chain B

Receptor sequence

>3lw0B (length=292) Species: 9606 (Homo sapiens)

AADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAI
KTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELM
TRGDLKSYLRSLRPPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNC
MVAEDFTVKIGDFGMTRDIYETDYYRKGLLPVRWMSPESLKDGVFTTYSD
VWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFEL
MRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK

3D structure

• PDB: 3lw0 Allosteric IGF-1R Inhibitors.
• Chain: B
• Resolution: 1.79 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D1135 R1139 N1140 D1153 E1162
• Catalytic site (residue number reindexed from 1): D144 R148 N149 D162 E171
• Enzyme Commision number: 2.7.10.1: receptor protein-tyrosine kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CCX	B	M1054 V1063 M1079 H1133 R1134 L1173 L1174 F1189	M72 V81 M97 H142 R143 L179 L180 F195
BS02	CCX	B	Y1090 K1111 M1115 E1118 D1146 F1147 E1271 P1272	Y108 K120 M124 E127 D155 F156 E277 P278
BS03	CCX	B	G1273 V1277	G279 V283

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004713 protein tyrosine kinase activity
• GO:0004714 transmembrane receptor protein tyrosine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation
• GO:0007169 cell surface receptor protein tyrosine kinase signaling pathway

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:3lw0, PDBe:3lw0, PDBj:3lw0
• PDBsum: 3lw0
• PubMed: 24900194
• UniProt: P08069|IGF1R_HUMAN Insulin-like growth factor 1 receptor (Gene Name=IGF1R)