Structure of PDB 3lqr Chain B

Receptor sequence
>3lqrB (length=501) Species: 6239 (Caenorhabditis elegans) [Search protein sequence]
MLCEIECRALSTAHTRLIHDFEPRDALTYLEGKNIFTEDHSELISKMSTR
LERIANFLRIYRRQASELGPLIDFFNYNNQSHLADFLEDYIDFAINEPDL
LRPVVIAPQFSRQMLDRKLLLGNVPKQMTCYIREYHVDRVIKKLDEMCDL
DSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKST
FDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFD
DVVQEETIRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYD
FLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQ
LNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMP
PGVDIPVKLWSCVIPVLDDEVADRLKRLSKRGALLSGKRMPVLTFKIDHI
IHMFLKHVVDAQTIANGISILEQRLLEIETVIRPEDFPKFMQLHQKFYDS
L
3D structure
PDB3lqr Crystal structure of the Caenorhabditis elegans apoptosome reveals an octameric assembly of CED-4.
ChainB
Resolution3.896 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG B S166 D250 S166 D250
BS02 ATP B Y131 G162 G164 K165 S166 V167 R273 A331 M334 Y369 Y131 G162 G164 K165 S166 V167 R273 A331 M334 Y369
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008656 cysteine-type endopeptidase activator activity involved in apoptotic process
GO:0016505 peptidase activator activity involved in apoptotic process
GO:0042802 identical protein binding
GO:0043531 ADP binding
GO:0046872 metal ion binding
GO:0051432 BH1 domain binding
GO:0051434 BH3 domain binding
GO:0061133 endopeptidase activator activity
GO:0089720 caspase binding
Biological Process
GO:0006915 apoptotic process
GO:0006919 activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0008361 regulation of cell size
GO:0009792 embryo development ending in birth or egg hatching
GO:0010954 positive regulation of protein processing
GO:0030042 actin filament depolymerization
GO:0030155 regulation of cell adhesion
GO:0031647 regulation of protein stability
GO:0040034 regulation of development, heterochronic
GO:0042981 regulation of apoptotic process
GO:0043065 positive regulation of apoptotic process
GO:0046716 muscle cell cellular homeostasis
GO:0048598 embryonic morphogenesis
GO:0050829 defense response to Gram-negative bacterium
GO:0097202 activation of cysteine-type endopeptidase activity
GO:1900118 negative regulation of execution phase of apoptosis
GO:1902742 apoptotic process involved in development
GO:1904747 positive regulation of apoptotic process involved in development
GO:1905808 positive regulation of synapse pruning
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0008303 caspase complex
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3lqr, PDBe:3lqr, PDBj:3lqr
PDBsum3lqr
PubMed20434985
UniProtP30429|CED4_CAEEL Cell death protein 4 (Gene Name=ced-4)

[Back to BioLiP]