Structure of PDB 3lqd Chain B

Receptor sequence

>3lqdB (length=146) Species: 9983 (Lepus europaeus)

VHLSGEEKSAVTALWGKVNVEEVGGETLGRLLVVYPWTQRFFESFGDLST
ASAVMGNPKVKAHGKKVLAAFSEGLSHLDNLKGTFAKLSELHCDKLHVDP
ENFRLLGNVLVIVLSHHFGKEFTPQVQAAYQKVVAGVANALAHKYH

3D structure

• PDB: 3lqd Crystal structure determination of Lepus europaeus 2.8 A resolution
• Chain: B
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	F42 H63 A70 F71 L88 H92 L96 V98 N102 L106	F42 H63 A70 F71 L88 H92 L96 V98 N102 L106

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0031721 hemoglobin alpha binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:3lqd, PDBe:3lqd, PDBj:3lqd
• PDBsum: 3lqd
• UniProt: P08535|HBB_LEPEU Hemoglobin subunit beta (Gene Name=HBB)