Structure of PDB 3lpe Chain B |
>3lpeB (length=59) Species: 2190 (Methanocaldococcus jannaschii) [Search protein sequence] |
MRACLKCKYLTNDEICPICHSPTSENWIGLLIVINPEKSEIAKKAGIDIK GKYALSVKE |
|
PDB | 3lpe Spt4/5 stimulates transcription elongation through the RNA polymerase clamp coiled-coil motif. |
Chain | B |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
2.7.7.6: DNA-directed RNA polymerase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
C4 C7 C16 C19 |
C4 C7 C16 C19 |
|
|
|
|