Structure of PDB 3lk0 Chain B

Receptor sequence

>3lk0B (length=89) Species: 9913 (Bos taurus) [Search protein sequence]

MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKE
QEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF

3D structure

PDB

3lk0 In vitro screening and structural characterization of inhibitors of the S100B-p53 interaction.

Chain

Resolution

2.04 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	B	D61 D63 D65 E67 E72	D62 D64 D66 E68 E73
BS02	CA	B	S18 E21 D23 K26 E31	S19 E22 D24 K27 E32
BS03	Z80	B	H42 F87	H43 F88	MOAD: Kd=696.9uM PDBbind-CN: -logKd/Ki=3.16,Kd=696.9uM

Gene Ontology

	Molecular Function
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0019210	kinase inhibitor activity
GO:0042803	protein homodimerization activity
GO:0044548	S100 protein binding
GO:0046872	metal ion binding
GO:0048156	tau protein binding
GO:0048306	calcium-dependent protein binding
GO:0050786	RAGE receptor binding

	Biological Process
GO:0006417	regulation of translation
GO:0007155	cell adhesion
GO:0007409	axonogenesis
GO:0007611	learning or memory
GO:0008284	positive regulation of cell population proliferation
GO:0016310	phosphorylation
GO:0043123	positive regulation of canonical NF-kappaB signal transduction
GO:0045917	positive regulation of complement activation
GO:0048143	astrocyte activation
GO:0071638	negative regulation of monocyte chemotactic protein-1 production
GO:0097490	sympathetic neuron projection extension
GO:1990845	adaptive thermogenesis

External links

PDB	RCSB:3lk0, PDBe:3lk0, PDBj:3lk0
PDBsum	3lk0
PubMed	21132089
UniProt	P02638\|S100B_BOVIN Protein S100-B (Gene Name=S100B)