Structure of PDB 3ldw Chain B

Receptor sequence

>3ldwB (length=353) Species: 126793 (Plasmodium vivax Sal-1)

FFRNMYDKYRDAFLSHLNEYSLEEEIKEHISKYYKLLFDYNCLGGKNNRG
ILVILIYEYVKNSSEWEKAACLAWCIEILQAAFLVADDIMDKGEMRRNKY
CWYLLKDVETKNAVNDVLLLYNSIYKLIEIYLRNESCYVDVIATFRDATL
KTIIGQHLDTNIFSDKYSHREIDVNNINVPEQPVIDINMINFGVYKNIVI
HKTAYYSFFLPIVCGMLLAGIANLIYKKIEDISMLMGEYFQIHDDYLDIF
GDSTKTGKVGSDIQNNKLTWPLIKTFELCSEPDKIKIVKNYGKNNLACVK
VIDSLYEQYKIRKHYESYEKAQKAKILSAINELHHEGIEYVLKYLLEILF
TGV

3D structure

• PDB: 3ldw Molecular characterization of a novel geranylgeranyl pyrophosphate synthase from Plasmodium parasites.
• Chain: B
• Resolution: 2.47 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K81 A121 D126 D130 R135 D198 K243 F283 D287 D288
• Catalytic site (residue number reindexed from 1): K46 A82 D87 D91 R96 D159 K202 F240 D244 D245

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZOL	B	D126 R135 Q195 K243 T244 D287 K301	D87 R96 Q156 K202 T203 D244 K258	MOAD: Ki=10.7nM
BS02	IPE	B	K81 R84 Q119 R136 F283 D287	K46 R49 Q80 R97 F240 D244
BS03	MG	B	D126 D130	D87 D91
BS04	MG	B	D126 D130	D87 D91

Gene Ontology

Molecular Function

• GO:0004161 dimethylallyltranstransferase activity
• GO:0004337 geranyltranstransferase activity
• GO:0004659 prenyltransferase activity
• GO:0016740 transferase activity
• GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
• GO:0046872 metal ion binding

Biological Process

• GO:0008299 isoprenoid biosynthetic process
• GO:0045337 farnesyl diphosphate biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0016020 membrane

External links

• PDB: RCSB:3ldw, PDBe:3ldw, PDBj:3ldw
• PDBsum: 3ldw
• PubMed: 21084289
• UniProt: A5K4U6