Structure of PDB 3l9y Chain B

Receptor sequence
>3l9yB (length=154) Species: 7091 (Bombyx mori) [Search protein sequence]
MPAKAVCVLRGDVSGTVFFDQQDEKSPVVVSGEVQGLTKGKHGFHVHEFG
DNTNGCTSAGAHFNPEKQDHGGPSSAVRHVGDLGNIEAIEDAGVTKVSIQ
DSQISLHGPNSIIGRTLVVHADPDDLGLGGNELSKTTGNAGGRIACGVIG
LAKI
3D structure
PDB3l9y Crystal structures of holo and Cu-deficient Cu/Zn-SOD from the silkworm Bombyx mori and the implications in amyotrophic lateral sclerosis.
ChainB
Resolution1.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H45 H47 H62 H70 H79 D82 H120 R143
Catalytic site (residue number reindexed from 1) H45 H47 H62 H70 H79 D82 H120 R143
Enzyme Commision number 1.15.1.1: superoxide dismutase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN B H62 H70 H79 D82 H62 H70 H79 D82
BS02 CU B H45 H47 H62 H120 H45 H47 H62 H120
Gene Ontology
Molecular Function
GO:0004784 superoxide dismutase activity
GO:0005507 copper ion binding
GO:0008270 zinc ion binding
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006801 superoxide metabolic process
GO:0019430 removal of superoxide radicals
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3l9y, PDBe:3l9y, PDBj:3l9y
PDBsum3l9y
PubMed20310068
UniProtP82205|SODC_BOMMO Superoxide dismutase [Cu-Zn]

[Back to BioLiP]