Structure of PDB 3l1t Chain B

Receptor sequence

>3l1tB (length=441) Species: 83333 (Escherichia coli K-12)

TVEAKNETFAPQHPDQYLSWKATSEQSERVDALAEDPRLVILWAGYPFSR
DYNKPRGHAFAVTDVRETLRTGAPKNAEDGPLPMACWSCKSPDVARLIQK
DGEDGYFHGKWARGGPEIVNNLGCADCHNTASPEFAKGKPELTLSRPYAA
RAMEAIGKPFEKAGRFDQQSMVCGQCHVEYYFDGKNKAVKFPWDDGMKVE
NMEQYYDKIAFSDWTNSLSKTPMLKAQHPEYETWTAGIHGKNNVTCIDCH
MPKVQNAEGKLYTDHKIGNPFDNFAQTCANCHTQDKAALQKVVAERKQSI
NDLKIKVEDQLVHAHFEAKAALDAGATEAEMKPIQDDIRHAQWRWDLAIA
SHGIHMHAPEEGLRMLGTAMDKAADARTKLARLLATKGITHEIQIPDIST
KEKAQQAIGLNMEQIKAEKQDFIKTVIPQWEEQARKNGLLS

3D structure

• PDB: 3l1t Kinetic and thermodynamic resolution of the interactions between sulfite and the pentahaem cytochrome NrfA from Escherichia coli
• Chain: B
• Resolution: 2.3 Å

Enzymatic activity

• Enzyme Commision number: 1.7.2.2: nitrite reductase (cytochrome; ammonia-forming).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	B	E215 Y216 K261 Q263	E179 Y180 K225 Q227
BS02	HEC	B	N89 P91 D100 T104 R106 C122 C125 K126 C212 H213 Y216 H264	N53 P55 D64 T68 R70 C86 C89 K90 C176 H177 Y180 H228
BS03	HEC	B	Q52 W56 G159 C160 C163 H164 F171 G174 P176 R201 Q205 I283 K289 Y298 T299 H301	Q16 W20 G123 C124 C127 H128 F135 G138 P140 R165 Q169 I247 K253 Y262 T263 H265
BS04	HEC	B	Q62 P91 R92 G93 H94 F96 A97 D100 C125 L158 C209 C212 H213 H286 I303	Q26 P55 R56 G57 H58 F60 A61 D64 C89 L122 C173 C176 H177 H250 I267
BS05	HEC	B	H213 E266 W270 H275 V280 C282 C285 H286 P306 F307 H391 M392 H393	H177 E230 W234 H239 V244 C246 C249 H250 P270 F271 H355 M356 H357
BS06	HEC	B	H275 N278 V280 C314 C317 H318 R332 M392	H239 N242 V244 C278 C281 H282 R296 M356
BS07	SO3	B	F310 A311 K322	F274 A275 K286
BS08	SO3	B	Y216 H264	Y180 H228

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0005509 calcium ion binding
• GO:0016491 oxidoreductase activity
• GO:0016966 nitric oxide reductase activity
• GO:0020037 heme binding
• GO:0042279 nitrite reductase (cytochrome, ammonia-forming) activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009061 anaerobic respiration
• GO:0019645 anaerobic electron transport chain
• GO:0042128 nitrate assimilation

Cellular Component

• GO:0030288 outer membrane-bounded periplasmic space
• GO:0042597 periplasmic space

External links

• PDB: RCSB:3l1t, PDBe:3l1t, PDBj:3l1t
• PDBsum: 3l1t
• PubMed: 20629638
• UniProt: P0ABK9|NRFA_ECOLI Cytochrome c-552 (Gene Name=nrfA)