Structure of PDB 3l1p Chain B

Receptor sequence
>3l1pB (length=145) Species: 10090 (Mus musculus) [Search protein sequence]
KALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTISRFEA
LQLSLKNMSKLRPLLEKWVEEADNNENLQEISKSQARKRKRTSIENRVRW
SLETMFLKSPKPSLQQITHIANQLGLEKDVVRVWFSNRRQKGKRS
3D structure
PDB3l1p A unique Oct4 interface is crucial for reprogramming to pluripotency
ChainB
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B R20 T26 Q27 Q44 S48 R49 R97 T98 V139 W140 N143 R18 T24 Q25 Q42 S46 R47 R91 T92 V133 W134 N137
BS02 dna B S43 T45 T46 R49 S56 N59 R95 R97 K117 R138 R145 Q146 S41 T43 T44 R47 S54 N57 R89 R91 K111 R132 R139 Q140
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3l1p, PDBe:3l1p, PDBj:3l1p
PDBsum3l1p
PubMed23376973
UniProtP20263|PO5F1_MOUSE POU domain, class 5, transcription factor 1 (Gene Name=Pou5f1)

[Back to BioLiP]