Structure of PDB 3ktv Chain B

Receptor sequence
>3ktvB (length=106) Species: 9606 (Homo sapiens) [Search protein sequence]
ADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLN
VFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAA
EMIPKL
3D structure
PDB3ktv Structural insights into the assembly of the human and archaeal signal recognition particles.
ChainB
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B D13 R14 F15 I16 C17 Y19 Y22 T28 I29 R33 R34 P36 I37 K66 M67 Y68 S69 R70 R74 R81 R83 R101 D4 R5 F6 I7 C8 Y10 Y13 T19 I20 R24 R25 P27 I28 K57 M58 Y59 S60 R61 R65 R72 R74 R92
BS02 rna B S38 K39 L95 V96 Y107 S29 K30 L86 V87 Y98
Gene Ontology
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ktv, PDBe:3ktv, PDBj:3ktv
PDBsum3ktv
PubMed20179341
UniProtP09132|SRP19_HUMAN Signal recognition particle 19 kDa protein (Gene Name=SRP19)

[Back to BioLiP]