Structure of PDB 3koh Chain B

Receptor sequence
>3kohB (length=463) Species: 9606 (Homo sapiens) [Search protein sequence]
KLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTLYVGSQRMVVM
HGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGPTWKDIRRFSL
TTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVI
ADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPG
SHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSA
ERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEID
RVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRG
YLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPF
STGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGC
IPPRYKLCVIPRS
3D structure
PDB3koh Human cytochrome P450 2E1 structures with fatty acid analogs reveal a previously unobserved binding mode.
ChainB
Resolution2.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) T303 F430 C437
Catalytic site (residue number reindexed from 1) T273 F400 C407
Enzyme Commision number 1.14.13.n7: 4-nitrophenol 2-hydroxylase.
1.14.14.1: unspecific monooxygenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM B R100 I114 I115 R126 G300 T303 N367 L368 H370 F430 S431 R435 C437 A438 G439 R70 I84 I85 R96 G270 T273 N337 L338 H340 F400 S401 R405 C407 A408 G409
BS02 OIO B N206 F207 F298 A299 T303 N176 F177 F268 A269 T273 BindingDB: Kd=2.1e+4nM
Gene Ontology
Molecular Function
GO:0004497 monooxygenase activity
GO:0005506 iron ion binding
GO:0008392 arachidonate epoxygenase activity
GO:0016491 oxidoreductase activity
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0016712 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
GO:0018601 4-nitrophenol 2-monooxygenase activity
GO:0019825 oxygen binding
GO:0019899 enzyme binding
GO:0020037 heme binding
GO:0030544 Hsp70 protein binding
GO:0046872 metal ion binding
GO:0051879 Hsp90 protein binding
GO:0070330 aromatase activity
GO:0120319 long-chain fatty acid omega-1 hydroxylase activity
Biological Process
GO:0001676 long-chain fatty acid metabolic process
GO:0002933 lipid hydroxylation
GO:0006631 fatty acid metabolic process
GO:0006805 xenobiotic metabolic process
GO:0008202 steroid metabolic process
GO:0009617 response to bacterium
GO:0016098 monoterpenoid metabolic process
GO:0018885 carbon tetrachloride metabolic process
GO:0018910 benzene metabolic process
GO:0018960 4-nitrophenol metabolic process
GO:0019373 epoxygenase P450 pathway
GO:0042197 halogenated hydrocarbon metabolic process
GO:0042759 long-chain fatty acid biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3koh, PDBe:3koh, PDBj:3koh
PDBsum3koh
PubMed20463018
UniProtP05181|CP2E1_HUMAN Cytochrome P450 2E1 (Gene Name=CYP2E1)

[Back to BioLiP]