Structure of PDB 3kjl Chain B

Receptor sequence

>3kjlB (length=83) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

IQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESNFTQIL
STVEPKALEMVSDSTRETVLKQIREFLEEIVDT

3D structure

PDB

3kjl Structural basis for the interaction between yeast Spt-Ada-Gcn5 acetyltransferase (SAGA) complex components Sgf11 and Sus1.

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	Y22 L29 V42 K43 T46 K47 M50 E66 L70 L82 I85 R86 L89 E90	Y11 L18 V31 K32 T35 K36 M39 E54 L58 L70 I73 R74 L77 E78

Gene Ontology

	Molecular Function
GO:0003682	chromatin binding
GO:0003713	transcription coactivator activity
GO:0005515	protein binding
GO:0008047	enzyme activator activity

	Biological Process
GO:0000973	post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery
GO:0006325	chromatin organization
GO:0006357	regulation of transcription by RNA polymerase II
GO:0006368	transcription elongation by RNA polymerase II
GO:0006406	mRNA export from nucleus
GO:0015031	protein transport
GO:0016973	poly(A)+ mRNA export from nucleus
GO:0032880	regulation of protein localization
GO:0045893	positive regulation of DNA-templated transcription
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0051028	mRNA transport
GO:0071028	nuclear mRNA surveillance

	Cellular Component
GO:0000124	SAGA complex
GO:0000932	P-body
GO:0005634	nucleus
GO:0005643	nuclear pore
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0046695	SLIK (SAGA-like) complex
GO:0070390	transcription export complex 2
GO:0071819	DUBm complex

External links

PDB	RCSB:3kjl, PDBe:3kjl, PDBj:3kjl
PDBsum	3kjl
PubMed	20007317
UniProt	Q6WNK7\|SUS1_YEAST Transcription and mRNA export factor SUS1 (Gene Name=SUS1)