Structure of PDB 3khc Chain B

Receptor sequence
>3khcB (length=207) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
EPWQEPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMS
VAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAG
YPDFQPDACLINRYAPGAKLSLHQDKAEPDLRAPIVSVSLGLPAIFQFGG
LKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLT
FRQAGKK
3D structure
PDB3khc Structural and mutational analysis of Escherichia coli AlkB provides insight into substrate specificity and DNA damage searching.
ChainB
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.14.11.33: DNA oxidative demethylase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B T51 G53 Y55 M57 W69 G75 Y76 K127 S129 H131 R161 R210 T43 G45 Y47 M49 W61 G67 Y68 K119 S121 H123 R153 R202 PDBbind-CN: Kd=0.316uM
BS02 CO B H131 D133 H187 H123 D125 H179
BS03 AKG B N120 Y122 L128 H131 H187 I189 R204 N206 T208 R210 N112 Y114 L120 H123 H179 I181 R196 N198 T200 R202
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008198 ferrous iron binding
GO:0035515 oxidative RNA demethylase activity
GO:0035516 broad specificity oxidative DNA demethylase activity
GO:0046872 metal ion binding
GO:0051213 dioxygenase activity
Biological Process
GO:0006281 DNA repair
GO:0006307 DNA alkylation repair
GO:0035513 oxidative RNA demethylation
GO:0042245 RNA repair
GO:0070989 oxidative demethylation
GO:0072702 response to methyl methanesulfonate
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3khc, PDBe:3khc, PDBj:3khc
PDBsum3khc
PubMed20084272
UniProtP05050|ALKB_ECOLI Alpha-ketoglutarate-dependent dioxygenase AlkB (Gene Name=alkB)

[Back to BioLiP]