Structure of PDB 3kgr Chain B |
>3kgrB (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] |
DLPRPSISAEPGTVIPLGSHVTFVCRGPVGVQTFRLERESRSTYNDTEDV SQASPSESEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLVK |
|
PDB | 3kgr Crystal structure and collagen-binding site of immune inhibitory receptor LAIR-1: unexpected implications for collagen binding by platelet receptor GPVI |
Chain | B |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
GLY |
B |
D114 Y115 |
D90 Y91 |
|
|
|