Structure of PDB 3kcc Chain B

Receptor sequence
>3kccB (length=198) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKE
MILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQV
NPDILMRLSAQMARRLQVTSEKVGNLAFLLVTGRIAQTLLNLAKQPDAMT
HPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
3D structure
PDB3kcc The 1.6A resolution structure of activated D138L mutant of catabolite gene activator protein with two cAMP bound in each monomer
ChainB
Resolution1.66 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) V183
Catalytic site (residue number reindexed from 1) V175
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CMP B V49 I70 G71 E72 L73 R82 S83 A84 R123 V41 I62 G63 E64 L65 R74 S75 A76 R115
BS02 CMP B K57 E58 Q170 G173 Q174 G177 C178 S179 R180 K49 E50 Q162 G165 Q166 G169 C170 S171 R172
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003680 minor groove of adenine-thymine-rich DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0008301 DNA binding, bending
GO:0030552 cAMP binding
GO:0042802 identical protein binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0045013 carbon catabolite repression of transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3kcc, PDBe:3kcc, PDBj:3kcc
PDBsum3kcc
PubMed21255606
UniProtP0ACJ8|CRP_ECOLI DNA-binding transcriptional dual regulator CRP (Gene Name=crp)

[Back to BioLiP]