Structure of PDB 3kan Chain B |
>3kanB (length=117) Species: 9606 (Homo sapiens) [Search protein sequence] |
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALS GSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFF PLESWQIGKIGTVMTFL |
|
PDB | 3kan Targeting distinct tautomerase sites of D-DT and MIF with a single molecule for inhibition of neutrophil lung recruitment. |
Chain | B |
Resolution | 1.13 Å |
3D structure |
|
|
Enzyme Commision number |
4.1.1.84: D-dopachrome decarboxylase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
RW1 |
B |
P1 F2 R36 N38 |
P1 F2 R36 N38 |
|
|
|
|