Structure of PDB 3k2s Chain B

Receptor sequence
>3k2sB (length=243) Species: 9606 (Homo sapiens) [Search protein sequence]
DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNW
DSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPY
LDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRD
RARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHL
STLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
3D structure
PDB3k2s Double superhelix model of high density lipoprotein.
ChainB
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLR B F104 W108 F104 W108
Gene Ontology
Molecular Function
GO:0001540 amyloid-beta binding
GO:0005102 signaling receptor binding
GO:0005319 lipid transporter activity
GO:0005515 protein binding
GO:0005543 phospholipid binding
GO:0008035 high-density lipoprotein particle binding
GO:0008289 lipid binding
GO:0015485 cholesterol binding
GO:0019899 enzyme binding
GO:0031072 heat shock protein binding
GO:0034190 apolipoprotein receptor binding
GO:0034191 apolipoprotein A-I receptor binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0045499 chemorepellent activity
GO:0048018 receptor ligand activity
GO:0060228 phosphatidylcholine-sterol O-acyltransferase activator activity
GO:0070653 high-density lipoprotein particle receptor binding
GO:0071813 lipoprotein particle binding
GO:0120020 cholesterol transfer activity
Biological Process
GO:0001935 endothelial cell proliferation
GO:0002719 negative regulation of cytokine production involved in immune response
GO:0006644 phospholipid metabolic process
GO:0006656 phosphatidylcholine biosynthetic process
GO:0006695 cholesterol biosynthetic process
GO:0006869 lipid transport
GO:0007179 transforming growth factor beta receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007229 integrin-mediated signaling pathway
GO:0008203 cholesterol metabolic process
GO:0008211 glucocorticoid metabolic process
GO:0010804 negative regulation of tumor necrosis factor-mediated signaling pathway
GO:0010875 positive regulation of cholesterol efflux
GO:0010903 negative regulation of very-low-density lipoprotein particle remodeling
GO:0018158 protein oxidation
GO:0018206 peptidyl-methionine modification
GO:0019915 lipid storage
GO:0030300 regulation of intestinal cholesterol absorption
GO:0030301 cholesterol transport
GO:0030325 adrenal gland development
GO:0032489 regulation of Cdc42 protein signal transduction
GO:0032691 negative regulation of interleukin-1 beta production
GO:0033344 cholesterol efflux
GO:0033700 phospholipid efflux
GO:0034115 negative regulation of heterotypic cell-cell adhesion
GO:0034375 high-density lipoprotein particle remodeling
GO:0034380 high-density lipoprotein particle assembly
GO:0034384 high-density lipoprotein particle clearance
GO:0035025 positive regulation of Rho protein signal transduction
GO:0042158 lipoprotein biosynthetic process
GO:0042632 cholesterol homeostasis
GO:0043534 blood vessel endothelial cell migration
GO:0043691 reverse cholesterol transport
GO:0050728 negative regulation of inflammatory response
GO:0050766 positive regulation of phagocytosis
GO:0050821 protein stabilization
GO:0050919 negative chemotaxis
GO:0051180 vitamin transport
GO:0051345 positive regulation of hydrolase activity
GO:0051496 positive regulation of stress fiber assembly
GO:0055090 acylglycerol homeostasis
GO:0055091 phospholipid homeostasis
GO:0060354 negative regulation of cell adhesion molecule production
GO:0060761 negative regulation of response to cytokine stimulus
GO:0070328 triglyceride homeostasis
GO:0070371 ERK1 and ERK2 cascade
GO:0070508 cholesterol import
GO:0071402 cellular response to lipoprotein particle stimulus
GO:0090205 positive regulation of cholesterol metabolic process
GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
GO:1902995 positive regulation of phospholipid efflux
GO:1905920 positive regulation of CoA-transferase activity
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005769 early endosome
GO:0005788 endoplasmic reticulum lumen
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0030139 endocytic vesicle
GO:0031410 cytoplasmic vesicle
GO:0034361 very-low-density lipoprotein particle
GO:0034362 low-density lipoprotein particle
GO:0034364 high-density lipoprotein particle
GO:0034366 spherical high-density lipoprotein particle
GO:0034774 secretory granule lumen
GO:0042627 chylomicron
GO:0062023 collagen-containing extracellular matrix
GO:0070062 extracellular exosome
GO:0071682 endocytic vesicle lumen
GO:0072562 blood microparticle
GO:1903561 extracellular vesicle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3k2s, PDBe:3k2s, PDBj:3k2s
PDBsum3k2s
PubMed19812036
UniProtP02647|APOA1_HUMAN Apolipoprotein A-I (Gene Name=APOA1)

[Back to BioLiP]