Structure of PDB 3jv7 Chain B

Receptor sequence

>3jv7B (length=345) Species: 1830 (Rhodococcus ruber)

MKAVQYTEIGSEPVVVDIPTPTPGPGEILLKVTAAGLCHSDIFVMDMPAA
QYAYGLPLTLGHEGVGTVAELGEGVTGFGVGDAVAVYGPWGCGACHACAR
GRENYCTRAADLGITPPGLGSPGSMAEYMIVDSARHLVPIGDLDPVAAAP
LTDAGLTPYHAISRVLPLLGPGSTAVVIGVGGLGHVGIQILRAVSAARVI
AVDLDDDRLALAREVGADAAVKSGAGAADAIRELTGGQGATAVFDFVGAQ
STIDTAQQVVAVDGHISVVGIHAGAHAKVGFFMIPFGASVVTPYWGTRSE
LMEVVALARAGRLDIHTETFTLDEGPAAYRRLREGSIRGRGVVVP

3D structure

• PDB: 3jv7 Structural insights into substrate specificity and solvent tolerance in alcohol dehydrogenase ADH-'A' from Rhodococcus ruber DSM 44541.
• Chain: B
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C38 H39 S40 F43 H62 E63 C92 C95 C98 C106 A110 D153 T157 R340
• Catalytic site (residue number reindexed from 1): C38 H39 S40 F43 H62 E63 C92 C95 C98 C106 A110 D153 T157 R340
• Enzyme Commision number: 1.1.1.1: alcohol dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C95 C98 C106	C95 C98 C106
BS02	ZN	B	C38 H62 D153	C38 H62 D153
BS03	NAD	B	C38 H39 S40 D153 T157 V180 G181 G182 L183 D203 L204 R208 S223 F246 V247 T252 V269 G270 I271 Y294 W295	C38 H39 S40 D153 T157 V180 G181 G182 L183 D203 L204 R208 S223 F246 V247 T252 V269 G270 I271 Y294 W295

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004022 alcohol dehydrogenase (NAD+) activity
• GO:0008270 zinc ion binding
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding

External links

• PDB: RCSB:3jv7, PDBe:3jv7, PDBj:3jv7
• PDBsum: 3jv7
• PubMed: 20676439
• UniProt: Q8KLT9