Structure of PDB 3jt2 Chain B |
>3jt2B (length=128) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHSWVL STAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVS KLKEGEQYMFFCTFPGHSALLKGTLTLK |
|
PDB | 3jt2 Rationally tuning the reduction potential of a single cupredoxin beyond the natural range. |
Chain | B |
Resolution | 2.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
B |
G45 H46 C112 H117 |
G45 H46 C112 H117 |
|
|
|
|