Structure of PDB 3jso Chain B

Receptor sequence
>3jsoB (length=189) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALA
RKGVIEIVSGASRGIRLLGLPLVGRVAAGEIEGHYQVDPSLFKPNADFLL
RVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVARLKKQGN
KVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNGDWL
3D structure
PDB3jso Structure of the LexA-DNA complex and implications for SOS box measurement.
ChainB
Resolution2.29 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) M118 S119 E152 A156
Catalytic site (residue number reindexed from 1) M105 S106 E139 A143
Enzyme Commision number 3.4.21.88: repressor LexA.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B T27 R28 N41 K48 S60 R64 T26 R27 N40 K47 S59 R63 PDBbind-CN: Kd=0.80nM
BS02 dna B T5 R7 F37 R38 S39 N41 A42 E45 H46 R52 G61 S63 T4 R6 F36 R37 S38 N40 A41 E44 H45 R51 G60 S62 PDBbind-CN: Kd=0.80nM
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0004252 serine-type endopeptidase activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
GO:0042802 identical protein binding
Biological Process
GO:0006260 DNA replication
GO:0006281 DNA repair
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0006508 proteolysis
GO:0006974 DNA damage response
GO:0009432 SOS response
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jso, PDBe:3jso, PDBj:3jso
PDBsum3jso
PubMed20703307
UniProtP0A7C2|LEXA_ECOLI LexA repressor (Gene Name=lexA)

[Back to BioLiP]