Structure of PDB 3jsd Chain B

Receptor sequence

>3jsdB (length=30) Species: 9606 (Homo sapiens)

FVNQHLCASHLVEALYLVCGERGFFYTPKT

3D structure

• PDB: 3jsd The structure of 2Zn pig insulin crystals at 1.5 A resolution.
• Chain: B
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	F1 N3 H5 L6 C7 L15 V18 C19 R22 G23 F24 F25 T30	F1 N3 H5 L6 C7 L15 V18 C19 R22 G23 F24 F25 T30

Gene Ontology

Molecular Function

• GO:0005179 hormone activity

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:3jsd, PDBe:3jsd, PDBj:3jsd
• PDBsum: 3jsd
• UniProt: P01308|INS_HUMAN Insulin (Gene Name=INS)