Structure of PDB 3jrv Chain B

Receptor sequence
>3jrvB (length=144) Species: 10254 (Vaccinia virus WR) [Search protein sequence]
DYEDAVFYFVDDDKICSRDSIIDLIDEYITWRNHVIVFNKDITSCGRLYK
ELMKFDDVAIRYYGIDKINEIVEAMSEGDHYINFTKVHDQESLFATIGIC
AKITEHWGYKKISESRFQSLGNITDLMTDDNINILILFLEKKLN
3D structure
PDB3jrv Structural basis for targeting of human RNA helicase DDX3 by poxvirus protein K7
ChainB
Resolution1.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B I27 D28 D31 I34 N38 Y86 T109 W112 R121 F122 Q123 L125 G126 N127 I128 T129 I22 D23 D26 I29 N33 Y81 T104 W107 R116 F117 Q118 L120 G121 N122 I123 T124
BS02 peptide B V11 F12 Y13 V6 F7 Y8
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0140311 protein sequestering activity
Biological Process
GO:0019049 virus-mediated perturbation of host defense response
GO:0039548 symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF3 activity
GO:0052170 symbiont-mediated suppression of host innate immune response
GO:0085034 symbiont-mediated suppression of host NF-kappaB cascade
Cellular Component
GO:0030430 host cell cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jrv, PDBe:3jrv, PDBj:3jrv
PDBsum3jrv
PubMed19913487
UniProtP68466|PG044_VACCW Protein K7 (Gene Name=OPG044)

[Back to BioLiP]