Structure of PDB 3j6b Chain B

Receptor sequence

>3j6bB (length=295) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

LIKRRRKLSKEVTQMKRLKPVSPGLRWYRSPIYPYLYKGRPVRALTVVRK
KHGGRNNSGKITVRHQGGGHRNRTRLIDFNRWEGGAQTVQRIEYDPGRSS
HIALLKHNTTGELSYIIACDGLRPGDVVESFRRGIPLSVKTTQRGNCLPI
SMIPIGTIIHNVGITPVGPGKFCRSAGTYARVLAKLPEKKKAIVRLQSGE
HRYVSLEAVATIGVVSNIDHQNRSLGKAGRSRWLGIRPTVRGVAMNKCDH
PHGGGRGKSKSNKLSMSPWGQLAKGYKTRRGKNQNRMKVKDRPRG

3D structure

PDB

3j6b Structure of the yeast mitochondrial large ribosomal subunit.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	K94 L96 K97 P98 V99 S100 P101 G102 L103 R104 W105 R118 V126 R127 K128 K129 H130 G132 R133 N134 N135 S136 G137 K138 I139 T140 V141 R142 H143 Q144 G146 H148 R149 N150 R151 T152 R153 Y172 P174 G175 R176 P259 V260 K264 F265 C266 R267 S268 A269 K282 L289 Q290 S291 E293 R295 Q314 S317 L318 G319 K320 A321 G322 R323 S324 R325 W326 R330 P331 T332 V333 R334 G335 V336 A337 M338 N339 K340 C341 D342 H343 H345 G348 R349 G350 K351 K353 S354 N355 K356 L357 S358 M359 S360 P361 W362 Q364 L365 A366 K367 G368 Y369 K370 T371 R372 R373 K375 N378 R379 R385 G388	K16 L18 K19 P20 V21 S22 P23 G24 L25 R26 W27 R40 V48 R49 K50 K51 H52 G54 R55 N56 N57 S58 G59 K60 I61 T62 V63 R64 H65 Q66 G68 H70 R71 N72 R73 T74 R75 Y94 P96 G97 R98 P166 V167 K171 F172 C173 R174 S175 A176 K189 L196 Q197 S198 E200 R202 Q221 S224 L225 G226 K227 A228 G229 R230 S231 R232 W233 R237 P238 T239 V240 R241 G242 V243 A244 M245 N246 K247 C248 D249 H250 H252 G255 R256 G257 K258 K260 S261 N262 K263 L264 S265 M266 S267 P268 W269 Q271 L272 A273 K274 G275 Y276 K277 T278 R279 R280 K282 N285 R286 R292 G295

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3j6b, PDBe:3j6b, PDBj:3j6b
PDBsum	3j6b
PubMed	24675956
UniProt	P32611\|RML2_YEAST Large ribosomal subunit protein uL2m (Gene Name=RML2)

[Back to BioLiP]