Structure of PDB 3ix9 Chain B

Receptor sequence
>3ix9B (length=166) Species: 1313 (Streptococcus pneumoniae) [Search protein sequence]
TKKIVAIWAQDEEGVIGKDNRLPWYLPAELQHFKETTLNHAILMGRVTFD
GMGRRLLPKRETLILTRNPEEKIDGVATFHDVQSVLDWYSAQEKNLYIVG
GKQIFQAFEPYLDEVIVTHIHARVEGDTYFPAEFDLSLFETVSSKFYTKD
EKNPYDFTIQYRKRKE
3D structure
PDB3ix9 Kinetic and structural characterization of dihydrofolate reductase from Streptococcus pneumoniae
ChainB
Resolution1.95 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) I8 L23 W25 E30 L31 F34 L58 L97 T119
Catalytic site (residue number reindexed from 1) I7 L22 W24 E29 L30 F33 L57 L96 T118
Enzyme Commision number 1.5.1.3: dihydrofolate reductase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NDP B W9 A10 I17 N21 R22 L23 W25 G46 R47 V48 T49 L66 T67 R68 H81 V100 G101 G102 K103 Q104 I105 W8 A9 I16 N20 R21 L22 W24 G45 R46 V47 T48 L65 T66 R67 H80 V99 G100 G101 K102 Q103 I104
BS02 MTX B I8 W9 L23 E30 L31 Q32 F34 K35 L58 R61 V100 I7 W8 L22 E29 L30 Q31 F33 K34 L57 R60 V99 MOAD: Ki=3.9nM
Gene Ontology
Molecular Function
GO:0004146 dihydrofolate reductase activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0050661 NADP binding
Biological Process
GO:0006730 one-carbon metabolic process
GO:0046452 dihydrofolate metabolic process
GO:0046654 tetrahydrofolate biosynthetic process
GO:0046655 folic acid metabolic process
GO:0046677 response to antibiotic
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ix9, PDBe:3ix9, PDBj:3ix9
PDBsum3ix9
PubMed19950924
UniProtQ54801|DYR_STRPN Dihydrofolate reductase (Gene Name=dhfR)

[Back to BioLiP]