Structure of PDB 3iwe Chain B

Receptor sequence

>3iweB (length=381) Species: 9606 (Homo sapiens)

SYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDLGD
RGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGVR
VVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLIR
EITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHLS
RNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVHQLLTRYLKQFHLTPV
MSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPSTIMNHPTHKS
LKAAYSFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLMENKTFLEKL
KFGIGDGNLQYYLYNWKCPSMGAEKVGLVLQ

3D structure

• PDB: 3iwe Crystal Structure of human type-I N-myristoyltransferase with bound myristoyl-CoA and inhibitor DDD85646
• Chain: B
• Resolution: 1.79 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N246 F247 L248 T282 Q496
• Catalytic site (residue number reindexed from 1): N131 F132 L133 T167 Q381
• Enzyme Commision number: 2.3.1.-
  2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MYA	B	Y117 Q118 F119 W120 Y180 V181 I245 N246 L248 V250 R255 S256 R258 A260 I264 T268 V271 F277 A279 Y281 T282 L287 Y479	Y2 Q3 F4 W5 Y65 V66 I130 N131 L133 V135 R140 S141 R143 A145 I149 T153 V156 F162 A164 Y166 T167 L172 Y364
BS02	646	B	V181 D183 F188 F190 N246 G284 Y296 H298 Y420 D471 Q496	V66 D68 F73 F75 N131 G169 Y181 H183 Y305 D356 Q381	BindingDB: Ki=11nM,IC50=4.0nM

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity

Biological Process

• GO:0006499 N-terminal protein myristoylation

External links

• PDB: RCSB:3iwe, PDBe:3iwe, PDBj:3iwe
• PDBsum: 3iwe
• UniProt: P30419|NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 (Gene Name=NMT1)