Structure of PDB 3ipe Chain B

Receptor sequence

>3ipeB (length=115) Species: 9606 (Homo sapiens)

CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT
TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA
LLSPYSYSTTAVVTN

3D structure

• PDB: 3ipe Trapping of palindromic ligands within native transthyretin prevents amyloid formation.
• Chain: B
• Resolution: 1.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	JZE	B	L17 A108 S117	L8 A99 S108	MOAD: ic50=0.15uM PDBbind-CN: -logKd/Ki=6.82,IC50=0.15uM

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:3ipe, PDBe:3ipe, PDBj:3ipe
• PDBsum: 3ipe
• PubMed: 21059958
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)