Structure of PDB 3iom Chain B

Receptor sequence

>3iomB (length=262) Species: 1773 (Mycobacterium tuberculosis)

DPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQAE
LPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRA
ARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNLTARSPLVGGEFVDL
TDAYSPRLRELARQSDPQLAEGVYAGLPGPHYETPAEIRMLQTLGADLVG
MSTVHETIAARAAGAEVLGVSLVTNLAAGITGEPLSHAEVLAAGAASATR
MGALLADVIARF

3D structure

• PDB: 3iom Crystallographic and docking studies of purine nucleoside phosphorylase from Mycobacterium tuberculosis.
• Chain: B
• Resolution: 2.14 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S36 H68 H90 Y92 E93 A120 M207 S208 N231 A233 H243
• Catalytic site (residue number reindexed from 1): S30 H62 H84 Y86 E87 A114 M201 S202 N225 A227 H237
• Enzyme Commision number: 2.4.2.1: purine-nucleoside phosphorylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SO4	B	G35 S36 R88 H90 S208	G29 S30 R82 H84 S202
BS02	GNG	B	S36 A120 A121 G122 Y188 E189 V205 G206 M207 T230 N231 H243 V246	S30 A114 A115 G116 Y182 E183 V199 G200 M201 T224 N225 H237 V240

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004731 purine-nucleoside phosphorylase activity
• GO:0016757 glycosyltransferase activity
• GO:0016763 pentosyltransferase activity

Biological Process

• GO:0006139 nucleobase-containing compound metabolic process
• GO:0006154 adenosine catabolic process
• GO:0006161 deoxyguanosine catabolic process
• GO:0009116 nucleoside metabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3iom, PDBe:3iom, PDBj:3iom
• PDBsum: 3iom
• PubMed: 20570524
• UniProt: P9WP01|PUNA_MYCTU Purine nucleoside phosphorylase (Gene Name=punA)