Structure of PDB 3imu Chain B |
>3imuB (length=114) Species: 9606 (Homo sapiens) [Search protein sequence] |
PLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTT EEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAAL LSPYSYSTTAVVTN |
|
PDB | 3imu A substructure combination strategy to create potent and selective transthyretin kinetic stabilizers that prevent amyloidogenesis and cytotoxicity. |
Chain | B |
Resolution | 1.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
IW4 |
B |
L110 S117 T118 |
L100 S107 T108 |
|
|
|
|