Structure of PDB 3if9 Chain B

Receptor sequence

>3if9B (length=363) Species: 1423 (Bacillus subtilis)

MKRHYEAVVIGGGIIGSAIAYYLAKENKNTALFESGTMGGRTTSAAAGML
SAHREEERDAFFDFAMHSQRLYKGLGEELYALSGVDIRQHNGGMFKLAFS
EEDVLQLRQMDDLDSVSWYSKEEVLEKEPYASGDIFGASFIQDDVHVEPY
FVCKAYVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGDVWANHVVVA
SGVWSGMFFKQLGLNNAFLPVKGECLSVWNDDIPLTKTLYHDACYIVPRK
SGRLVVGATMKPGDWSETPDLGGLESVMKKAKTMLPAIQNMKVDRFWAGL
RPGTKDGKPYIGRHPEDSRILFAAGHFRNGILLAPATGALISDLIMNKEV
NQDWLHAFRIDRK

3D structure

• PDB: 3if9 Glyphosate resistance by engineering the flavoenzyme glycine oxidase.
• Chain: B
• Resolution: 2.6 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): A47 G48 M49
• Catalytic site (residue number reindexed from 1): A47 G48 M49
• Enzyme Commision number: 1.4.3.19: glycine oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GOA	B	Y246 R302 R329	Y245 R301 R328
BS02	FAD	B	G13 I14 I15 E34 S35 R41 T42 T43 A45 A46 A47 G48 M49 P173 V174 S202 G203 W205 F209 G300 R302 H327 F328 R329 N330 G331 I332	G13 I14 I15 E34 S35 R41 T42 T43 A45 A46 A47 G48 M49 P172 V173 S201 G202 W204 F208 G299 R301 H326 F327 R328 N329 G330 I331

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0043799 glycine oxidase activity
• GO:0050660 flavin adenine dinucleotide binding
• GO:0071949 FAD binding

Biological Process

• GO:0006520 amino acid metabolic process
• GO:0009228 thiamine biosynthetic process
• GO:0009229 thiamine diphosphate biosynthetic process
• GO:0009635 response to herbicide

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3if9, PDBe:3if9, PDBj:3if9
• PDBsum: 3if9
• PubMed: 19864430
• UniProt: O31616|GLYOX_BACSU Glycine oxidase (Gene Name=thiO)