Structure of PDB 3ic3 Chain B |
>3ic3B (length=96) Species: 1076 (Rhodopseudomonas palustris) [Search protein sequence] |
AMTGPKQQPLPPDVEGREDAIEVLRAFVLDGGLSIAFMRAFEDPEMWGLL LVDIARHAARSYARESEYTEDEALERIVEMFEAELSRPTATTERTQ |
|
PDB | 3ic3 Structure of a putative pyruvate dehydrogenase from the photosynthetic bacterium Rhodopseudomonas palustrus CGA009 |
Chain | B |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
BGC |
B |
H56 R59 S60 R63 |
H57 R60 S61 R64 |
|
|
|