Structure of PDB 3iab Chain B

Receptor sequence

>3iabB (length=107) Species: 4932 (Saccharomyces cerevisiae)

RVTKHPSLKTLTHKQIHTTIFVKSTTPYVSALKRINKFLDSVHKQGSSYV
AVLGMGKAVEKTLALGCHFQDQKNKKIEVYTKTIEVLDEVIQLKKRAVSG
VELRIYV

3D structure

• PDB: 3iab Eukaryotic ribonucleases P/MRP: the crystal structure of the P3 domain
• Chain: B
• Resolution: 2.7 Å

Enzymatic activity

• Enzyme Commision number: 3.1.26.5: ribonuclease P.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	R14 S20 K22 I33 F34 V35 K36 S37 T39 P40 Y41 V42 S43 K46 R47 L66 G67 M68 K70 E73 K74 T96 I97 V99 R129 A130 S132	R1 S7 K9 I20 F21 V22 K23 S24 T26 P27 Y28 V29 S30 K33 R34 L53 G54 M55 K57 E60 K61 T83 I84 V86 R96 A97 S99
BS02	ZN	B	H26 H30	H13 H17
BS03	ZN	B	H26 H30	H13 H17

Gene Ontology

Molecular Function

• GO:0000171 ribonuclease MRP activity
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0004526 ribonuclease P activity
• GO:0005515 protein binding
• GO:0016787 hydrolase activity

Biological Process

• GO:0000294 nuclear-transcribed mRNA catabolic process, RNase MRP-dependent
• GO:0000460 maturation of 5.8S rRNA
• GO:0001682 tRNA 5'-leader removal
• GO:0006364 rRNA processing
• GO:0006396 RNA processing
• GO:0008033 tRNA processing
• GO:0034965 intronic box C/D snoRNA processing

Cellular Component

• GO:0000172 ribonuclease MRP complex
• GO:0005634 nucleus
• GO:0005655 nucleolar ribonuclease P complex
• GO:0005697 telomerase holoenzyme complex

External links

• PDB: RCSB:3iab, PDBe:3iab, PDBj:3iab
• PDBsum: 3iab
• PubMed: 20075859
• UniProt: P38291|POP7_YEAST Ribonucleases P/MRP protein subunit POP7 (Gene Name=POP7)