Structure of PDB 3hxb Chain B

Receptor sequence

>3hxbB (length=324) Species: 10116 (Rattus norvegicus)

QKDVTIKSDAPDTLLLEKHADYIASYGSDYEYCMSEYLRMSGVYWGLTVM
DLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTL
YDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLG
KLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQL
HQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHW
IDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIK
PVSPVFCMPEEVLQRVNVQPELVS

3D structure

• PDB: 3hxb Design, synthesis, and characterization of Peptide-based rab geranylgeranyl transferase inhibitors
• Chain: B
• Resolution: 2.25 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H190 R232 K235 D238 C240 Y241 D280 D287 H290
• Catalytic site (residue number reindexed from 1): H183 R225 K228 D231 C233 Y234 D273 D280 H283
• Enzyme Commision number: 2.5.1.60: protein geranylgeranyltransferase type II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BD5	B	S48 L96 R144 F147 G192 Q193 Y195 W244	S41 L89 R137 F140 G185 Q186 Y188 W237	PDBbind-CN: -logKd/Ki=5.39,IC50=4.1uM

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004659 prenyltransferase activity
• GO:0004661 protein geranylgeranyltransferase activity
• GO:0004663 Rab geranylgeranyltransferase activity
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0008318 protein prenyltransferase activity
• GO:0019840 isoprenoid binding
• GO:0031267 small GTPase binding
• GO:0046872 metal ion binding

Biological Process

• GO:0018344 protein geranylgeranylation

Cellular Component

• GO:0005968 Rab-protein geranylgeranyltransferase complex

External links

• PDB: RCSB:3hxb, PDBe:3hxb, PDBj:3hxb
• PDBsum: 3hxb
• PubMed: 19894725
• UniProt: Q08603|PGTB2_RAT Geranylgeranyl transferase type-2 subunit beta (Gene Name=Rabggtb)