Structure of PDB 3hx9 Chain B

Receptor sequence
>3hx9B (length=98) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
PVVKINAIEVPAGAGPELEKRFAHRAHAVENSPGFLGFQLLRPVKGEERY
FVVTHWESDEAFQAWANGPAIAAHAGHRANPVATGASLLEFEVVLDVG
3D structure
PDB3hx9 Unusual Diheme Conformation of the Heme-Degrading Protein from Mycobacterium tuberculosis
ChainB
Resolution1.75 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.14.99.57: heme oxygenase (mycobilin-producing).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM B R22 R26 A29 W66 A67 A71 H75 A80 R21 R25 A28 W65 A66 A70 H74 A79
BS02 HEM B N7 R22 F23 V30 F39 T55 P82 V83 A84 G86 N6 R21 F22 V29 F38 T54 P81 V82 A83 G85
Gene Ontology
Molecular Function
GO:0004392 heme oxygenase (decyclizing) activity
GO:0004497 monooxygenase activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0042167 heme catabolic process
Cellular Component
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3hx9, PDBe:3hx9, PDBj:3hx9
PDBsum3hx9
PubMed19917297
UniProtP9WKH3|MHUD_MYCTU Heme oxygenase (mycobilin-producing) (Gene Name=mhuD)

[Back to BioLiP]