Structure of PDB 3htn Chain B |
>3htnB (length=139) Species: 226186 (Bacteroides thetaiotaomicron VPI-5482) [Search protein sequence] |
NMYSYKKIGNKYIVSINNHTEIVKALNAFCKEKGILSGSINGIGAIGELT LRFFNPKDDKTFREQMEISNLTGNISSMNEQVYLHLHITVGRSDYSALAG HLLSAIQNGAGEFVVEDYSERISRTYNPDLGLNIYDFER |
|
PDB | 3htn Crystal structure of Putative DNA binding protein (NP_810029.1) from Bacteroides thetaiotaomicron VPI-5482 at 1.50 A resolution |
Chain | B |
Resolution | 1.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
B |
H131 H133 H147 |
H85 H87 H101 |
|
|
|