Structure of PDB 3hsn Chain B

Receptor sequence

>3hsnB (length=413) Species: 10116 (Rattus norvegicus)

PRFLKVKNWETDVVLTDTLHLKSTLETGCTEHICMGSIMLPSVRTKDQLF
PLAKEFLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYGA
KHAWRNASRCVGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNL
RSAITIFPQRTDGKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVQFTEIC
IQQGWKAPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPKFDWFK
DLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYN
ILEEVAKKMDLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSAT
ESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFE
YQPDPWNTHVWKG

3D structure

• PDB: 3hsn Single crystal structural and absorption spectral characterizations of nitric oxide synthase complexed with N(omega)-hydroxy-L-arginine and diatomic ligands.
• Chain: B
• Resolution: 1.91 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C415 R418 W587 E592
• Catalytic site (residue number reindexed from 1): C110 R113 W282 E287
• Enzyme Commision number: 1.14.13.39: nitric-oxide synthase (NADPH).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	H4B	B	F691 H692 E694	F386 H387 E389
BS02	ZN	B	C326 C331	C29 C34
BS03	HEM	B	W409 R414 C415 G417 F584 G586 W587 E592 W678 F704 Y706	W104 R109 C110 G112 F279 G281 W282 E287 W373 F399 Y401
BS04	H4B	B	S334 M336 R596 V677 W678	S37 M39 R291 V372 W373
BS05	HAR	B	Q478 P565 V567 G586 W587 Y588 E592 D597	Q173 P260 V262 G281 W282 Y283 E287 D292

Gene Ontology

Molecular Function

• GO:0004517 nitric-oxide synthase activity

Biological Process

• GO:0006809 nitric oxide biosynthetic process

External links

• PDB: RCSB:3hsn, PDBe:3hsn, PDBj:3hsn
• PDBsum: 3hsn
• PubMed: 19791770
• UniProt: P29476|NOS1_RAT Nitric oxide synthase 1 (Gene Name=Nos1)