Structure of PDB 3hsb Chain B

Receptor sequence

>3hsbB (length=69) Species: 1423 (Bacillus subtilis)

INIQDQFLNQIRKENTYVTVFLLNGFQLRGQVKGFDNFTVLLESEGKQQL
IYKHAISTFAPQKNVQLEL

3D structure

• PDB: 3hsb Crystal structure of Hfq from Bacillus subtilis in complex with SELEX-derived RNA aptamer: insight into RNA-binding properties of bacterial Hfq
• Chain: B
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	F24 L25 G28 F29 Q30 R32 S60 T61	F21 L22 G25 F26 Q27 R29 S57 T58

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0043487 regulation of RNA stability
• GO:0045974 regulation of translation, ncRNA-mediated

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3hsb, PDBe:3hsb, PDBj:3hsb
• PDBsum: 3hsb
• PubMed: 22053080
• UniProt: O31796|HFQ_BACSU RNA-binding protein Hfq (Gene Name=hfq)