Structure of PDB 3hq9 Chain B

Receptor sequence

>3hq9B (length=306) Species: 35554 (Geobacter sulfurreducens)

AADELQQRAQGLFKPVPAKAPTLKGNPASPVKVELGKMLYFDPRLSASHL
ISCNTCHNVGLGGGDLQATSTGHGWQKGPRNAPTVLNSVFNTAQFWDGRA
KDLQAPVEMNNTPDQVVKTLNSIPDYVALFKKAFPGEKDPVTFDNMAKAI
EVFEATLITPDSPFDQYLKGKKKALDGKQTAGLKLFLDKGCVACHGGLNL
GGTGYFPFGVVEKGRFAVTNTAKDEYVFRAPSLRNVAITYPYFHSGVVWS
LKEAVAVMGSAQFGIKLSDDESEAIAAFLGSLTGKQPKVVYPIMPASTDA
TPRPRL

3D structure

• PDB: 3hq9 CcpA from Geobacter sulfurreducens is a basic di-heme cytochrome c peroxidase.
• Chain: B
• Resolution: 1.52 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E136
• Catalytic site (residue number reindexed from 1): E108
• Enzyme Commision number: 1.11.1.5: cytochrome-c peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	C73 C76 H77 S90 R100 A102 P103 N111 F115 W116 M137 E182	C53 C56 H57 S70 R80 A82 P83 N91 F95 W96 M109 E154
BS02	HEM	B	C219 C222 H223 G237 V238 R268 A269 P270 L272 Y281 F282 H283 M297 F302	C191 C194 H195 G209 V210 R229 A230 P231 L233 Y242 F243 H244 M258 F263
BS03	CA	B	N101 T278 P280	N81 T239 P241

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding

External links

• PDB: RCSB:3hq9, PDBe:3hq9, PDBj:3hq9
• PDBsum: 3hq9
• PubMed: 19735665
• UniProt: Q749D0