Structure of PDB 3hq6 Chain B

Receptor sequence

>3hq6B (length=313) Species: 35554 (Geobacter sulfurreducens)

ADELQQRAQGLFKPVPAKAPTLKGNPASPVKVELGKMLYFDPRLSASHLI
SCNTCHNVGLGGGDLQATSTGHGWQKGPRNAPTVLNSVFNTAQFWDGRAK
DLAEQAKGPVQASVEMNNTPDQVVKTLNSIPDYVALFKKAFPGEKDPVTF
DNMAKAIEVFEATLITPDSPFDQYLKGKKKALDGKQTAGLKLFLDKGCVA
CHGGLNLGGTGYFPFGVVEKGRFAVTNTAKDEYVFRAPSLRNVAITYPYF
HSGVVWSLKEAVAVMGSAQFGIKLSDDESEAIAAFLGSLTGKQPKVVYPI
MPASTDATPRPRL

3D structure

• PDB: 3hq6 CcpA from Geobacter sulfurreducens is a basic di-heme cytochrome c peroxidase.
• Chain: B
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E136
• Catalytic site (residue number reindexed from 1): E115
• Enzyme Commision number: 1.11.1.5: cytochrome-c peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	C73 C76 H77 S90 G92 H93 W95 Q96 R100 A102 P103 Q114 W116 P130 E182	C52 C55 H56 S69 G71 H72 W74 Q75 R79 A81 P82 Q93 W95 P109 E161
BS02	HEM	B	C219 C222 H223 V238 R268 A269 P270 L272 Y281 F282 H283 M297 F302 I304	C198 C201 H202 V217 R236 A237 P238 L240 Y249 F250 H251 M265 F270 I272
BS03	CA	B	N101 T278 P280	N80 T246 P248

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding

External links

• PDB: RCSB:3hq6, PDBe:3hq6, PDBj:3hq6
• PDBsum: 3hq6
• PubMed: 19735665
• UniProt: Q749D0