Structure of PDB 3hj0 Chain B

Receptor sequence

>3hj0B (length=115) Species: 9606 (Homo sapiens)

CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT
TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA
LLSPYSYSTTAVVTN

3D structure

• PDB: 3hj0 Chemoselective small molecules that covalently modify one lysine in a non-enzyme protein in plasma.
• Chain: B
• Resolution: 1.34 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	A93	B	K15 L17 L110 S117 T118	K6 L8 L101 S108 T109	PDBbind-CN: -logKd/Ki=5.71,IC50=1.96uM BindingDB: IC50=1960nM

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:3hj0, PDBe:3hj0, PDBj:3hj0
• PDBsum: 3hj0
• PubMed: 20081815
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)