Structure of PDB 3hf4 Chain B

Receptor sequence

>3hf4B (length=145) Species: 10116 (Rattus norvegicus) [Search protein sequence]

VHLTDAEKAAVNGLWGKVNPDDVGGEALGRLLVVYPWTQRYFDSFGDLSS
ASAIMGNPKVKAHGKKVINAFNDGLKHLDNLKGTFAHLSELHCDKLHVDP
ENFRLLGNMIVIVLGHHLGKEFTPCAQAAFQKVVAGVASALAHKY

3D structure

PDB

3hf4 Quaternary structural variability in rat hemoglobin

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	Y41 F42 H63 K66 V67 L88 H92 L96 V98 N102 L106 L141	Y41 F42 H63 K66 V67 L88 H92 L96 V98 N102 L106 L141

Gene Ontology

	Molecular Function
GO:0004601	peroxidase activity
GO:0005344	oxygen carrier activity
GO:0019825	oxygen binding
GO:0020037	heme binding
GO:0030492	hemoglobin binding
GO:0031720	haptoglobin binding
GO:0031721	hemoglobin alpha binding
GO:0031722	hemoglobin beta binding
GO:0043177	organic acid binding
GO:0044877	protein-containing complex binding
GO:0046872	metal ion binding

	Biological Process
GO:0006749	glutathione metabolic process
GO:0015670	carbon dioxide transport
GO:0015671	oxygen transport
GO:0030097	hemopoiesis
GO:0030185	nitric oxide transport
GO:0042542	response to hydrogen peroxide
GO:0042744	hydrogen peroxide catabolic process
GO:0048821	erythrocyte development
GO:0070293	renal absorption
GO:0098869	cellular oxidant detoxification

	Cellular Component
GO:0005615	extracellular space
GO:0005833	hemoglobin complex
GO:0031838	haptoglobin-hemoglobin complex

External links

PDB	RCSB:3hf4, PDBe:3hf4, PDBj:3hf4
PDBsum	3hf4
PubMed
UniProt	P02091\|HBB1_RAT Hemoglobin subunit beta-1 (Gene Name=Hbb)