Structure of PDB 3h4n Chain B

Receptor sequence

>3h4nB (length=69) Species: 35554 (Geobacter sulfurreducens)

KVVVLEAKNGNVTFDHKKHAGVKGECKACHETEAGGKIAGMGKDWAHKTC
TGCHKEMGKGPTKCGECHK

3D structure

• PDB: 3h4n Structural characterization of a family of cytochromes c(7) involved in Fe(III) respiration by Geobacter sulfurreducens.
• Chain: B
• Resolution: 1.35 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	G59 G61	G58 G60
BS02	HEM	B	F15 H17 C27 C30 H31 G35 G36 K37 I38	F14 H16 C26 C29 H30 G35 G36 K37 I38
BS03	HEM	B	F15 K19 H20 V23 C51 C54 H55 P62	F14 K18 H19 V22 C50 C53 H54 P61
BS04	HEM	B	L6 E7 A8 K9 N10 V13 G42 K43 A46 H47 T52 K64 C65 C68 H69	L5 E6 A7 K8 N9 V12 G42 K43 A46 H47 T51 K63 C64 C67 H68

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

External links

• PDB: RCSB:3h4n, PDBe:3h4n, PDBj:3h4n
• PDBsum: 3h4n
• PubMed: 19857457
• UniProt: Q74ED8