Structure of PDB 3gxq Chain B |
>3gxqB (length=54) Species: 367830 (Staphylococcus aureus subsp. aureus USA300) [Search protein sequence] |
ENSVFFGKKKKVSLHLLVDPDMKDEIIKYAQEKDFDNVSQAGREILKKGL EQIA |
|
PDB | 3gxq The Staphylococcus aureus pSK41 plasmid-encoded ArtA protein is a master regulator of plasmid transmission genes and contains a RHH motif used in alternate DNA-binding modes. |
Chain | B |
Resolution | 2.35 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
|
|
|