Structure of PDB 3gl9 Chain B |
>3gl9B (length=121) Species: 2336 (Thermotoga maritima) [Search protein sequence] |
SKKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIV LDIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARK VMRKPFSPSQFIEEVKHLLNE |
|
PDB | 3gl9 Structural Insight into Partner Specificity and Phosphoryl Transfer in Two-Component Signal Transduction |
Chain | B |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
B |
D10 X53 M55 |
D9 X52 M54 |
|
|
|
|