Structure of PDB 3gc8 Chain B

Receptor sequence
>3gc8B (length=346) Species: 9606 (Homo sapiens) [Search protein sequence]
PRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVK
KLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVY
LVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKP
SNVAVNEDSELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQT
VDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSE
HARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEAL
AHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFK
3D structure
PDB3gc8 The three-dimensional structure of MAP kinase p38beta: different features of the ATP-binding site in p38beta compared with p38alpha.
ChainB
Resolution2.4 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D150 K152 N155 D168 T185
Catalytic site (residue number reindexed from 1) D147 K149 N152 D165 T182
Enzyme Commision number 2.7.11.24: mitogen-activated protein kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 B45 B V30 Y35 V38 A51 K53 L104 T106 L108 M109 G110 A111 S154 L167 V27 Y32 V35 A48 K50 L101 T103 L105 M106 G107 A108 S151 L164
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004707 MAP kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0106310 protein serine kinase activity
Biological Process
GO:0000165 MAPK cascade
GO:0001649 osteoblast differentiation
GO:0006468 protein phosphorylation
GO:0010628 positive regulation of gene expression
GO:0016310 phosphorylation
GO:0031098 stress-activated protein kinase signaling cascade
GO:0032735 positive regulation of interleukin-12 production
GO:0033554 cellular response to stress
GO:0035556 intracellular signal transduction
GO:0038066 p38MAPK cascade
GO:0045648 positive regulation of erythrocyte differentiation
GO:0051149 positive regulation of muscle cell differentiation
GO:0051403 stress-activated MAPK cascade
GO:0060038 cardiac muscle cell proliferation
GO:0060043 regulation of cardiac muscle cell proliferation
GO:0060044 negative regulation of cardiac muscle cell proliferation
GO:0060348 bone development
GO:0071347 cellular response to interleukin-1
GO:0071493 cellular response to UV-B
GO:0090398 cellular senescence
GO:0098586 cellular response to virus
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3gc8, PDBe:3gc8, PDBj:3gc8
PDBsum3gc8
PubMed19622861
UniProtQ15759|MK11_HUMAN Mitogen-activated protein kinase 11 (Gene Name=MAPK11)

[Back to BioLiP]