Structure of PDB 3g9c Chain B

Receptor sequence
>3g9cB (length=90) Species: 9606 (Homo sapiens) [Search protein sequence]
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAF
VIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
3D structure
PDB3g9c Structural and chemical basis for glucosamine 6-phosphate binding and activation of the glmS ribozyme
ChainB
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B Y13 N15 N16 E19 D24 S46 R47 S48 L49 K50 M51 R52 Q54 F56 K80 Q85 Y86 K88 T89 D90 S91 D92 Y7 N9 N10 E13 D18 S40 R41 S42 L43 K44 M45 R46 Q48 F50 K74 Q79 Y80 K82 T83 D84 S85 D86
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3g9c, PDBe:3g9c, PDBj:3g9c
PDBsum3g9c
PubMed19228039
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]