Structure of PDB 3g6w Chain B

Receptor sequence
>3g6wB (length=206) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence]
PLYVIDKPITLHILTQLRDKYTDQINFRKNLVRLGRILGYEISNTLDYEI
VEVETPLGVKTKGVDITDLNNIVIINILRAAVPLVEGLLKAFPKARQGVI
GASRKDMDVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEVVKAN
PKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDA
GDRAFG
3D structure
PDB3g6w Structural and kinetic studies of the allosteric transition in Sulfolobus solfataricus uracil phosphoribosyltransferase: Permanent activation by engineering of the C-terminus
ChainB
Resolution2.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) R105 D116 D209 D212
Catalytic site (residue number reindexed from 1) R104 D106 D199 D202
Enzyme Commision number 2.4.2.9: uracil phosphoribosyltransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GTP B K91 P94 K90 P93
BS02 GTP B K30 R34 R37 K29 R33 R36
BS03 HSX B R105 D140 A144 T145 A146 S147 T148 R104 D130 A134 T135 A136 S137 T138
BS04 POP B R80 A81 R79 A80
BS05 GTP B N27 K30 R34 N26 K29 R33
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004422 hypoxanthine phosphoribosyltransferase activity
GO:0004845 uracil phosphoribosyltransferase activity
GO:0005525 GTP binding
GO:0016757 glycosyltransferase activity
Biological Process
GO:0006178 guanine salvage
GO:0006223 uracil salvage
GO:0008655 pyrimidine-containing compound salvage
GO:0032263 GMP salvage
GO:0032264 IMP salvage
GO:0044206 UMP salvage
GO:0046100 hypoxanthine metabolic process
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3g6w, PDBe:3g6w, PDBj:3g6w
PDBsum3g6w
PubMed19683539
UniProtQ980Q4|UPP_SACS2 Uracil phosphoribosyltransferase (Gene Name=upp)

[Back to BioLiP]