Structure of PDB 3g6p Chain B

Receptor sequence
>3g6pB (length=81) Species: 10116 (Rattus norvegicus) [Search protein sequence]
SHMCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDK
IRRKNCPACRYRKCLQAGMNLEARKTKKKIK
3D structure
PDB3g6p DNA binding site sequence directs glucocorticoid receptor structure and activity.
ChainB
Resolution1.985 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B S459 V462 R466 R489 K490 R496 S23 V26 R30 R53 K54 R60 PDBbind-CN: Kd=0.44uM
BS02 dna B C450 H451 Y452 K461 K465 R510 C14 H15 Y16 K25 K29 R74 PDBbind-CN: Kd=0.44uM
BS03 ZN B C440 C443 C457 C460 C4 C7 C21 C24
BS04 ZN B C476 C482 C492 C495 C40 C46 C56 C59
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3g6p, PDBe:3g6p, PDBj:3g6p
PDBsum3g6p
PubMed19372434
UniProtP06536|GCR_RAT Glucocorticoid receptor (Gene Name=Nr3c1)

[Back to BioLiP]