Structure of PDB 3ft0 Chain B |
>3ft0B (length=129) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVL STAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVS KLKEGEQYMFFCAAAAHAAAAMKGTLTLK |
|
PDB | 3ft0 Metal-binding loop length and not sequence dictates structure. |
Chain | B |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
B |
H46 C112 H117 |
H46 C112 H117 |
|
|
|
|