Structure of PDB 3fc3 Chain B

Receptor sequence

>3fc3B (length=188) Species: 85963 (Helicobacter pylori J99) [Search protein sequence]

LKNDDFVIAKNQLGNIVPNSVGVIRAVNGKSAMVLFIGLNELKRVDFSEL
EAIDIYRTGKGYDKKICNICHILKNTDGFEINQTDAKGRKTTRPSCRECR
KNIDGVKLSSTEKKKMDEIAPPKGSVFTCPICEKRSIVGVTANLVHDHNH
DTGWGREWICDSCNTGLGRFKDNPKFLEKVIEYLKKYE

3D structure

PDB

3fc3 Crystal structure of the beta beta alpha-Me type II restriction endonuclease Hpy99I with target DNA.

Chain

Resolution

1.75 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	B	K61 N83 D86 A87 K88 R94 P95 R101 V146 H147 H149 N165 T166 G169 R170	K60 N82 D85 A86 K87 R93 P94 R100 V145 H146 H148 N164 T165 G168 R169
BS02	dna	B	E81 I82 N83 Q84 K91 T166	E80 I81 N82 Q83 K90 T165
BS03	ZN	B	C68 C71 C97 C100	C67 C70 C96 C99
BS04	ZN	B	C130 C133 C161 C164	C129 C132 C160 C163
BS05	NA	B	D148 H149 N165	D147 H148 N164
BS06	NA	B	Y57 Y63	Y56 Y62

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:3fc3, PDBe:3fc3, PDBj:3fc3
PDBsum	3fc3
PubMed	19380375
UniProt	Q9ZL26

[Back to BioLiP]